DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt3l2

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002941069.2 Gene:b4galt3l2 / 733985 XenbaseID:XB-GENE-5823209 Length:355 Species:Xenopus tropicalis


Alignment Length:233 Identity:87/233 - (37%)
Similarity:141/233 - (60%) Gaps:4/233 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRA 158
            :..||.::|..|::.:.||:|:|:|.||:.|...|.|:|.:|.:|.::|.|:::.|..:..||||
 Frog   112 VSKGGRYKPPDCESTHKTAVIIPHRGREQHLKYLLYYLHPFLQRQQLNYGIYIIHQAGNFTFNRA 176

  Fly   159 MLFNIGAQVA-AEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFGGVV 222
            .|.|:|.:.| .:..:.||..|||||:|.:...||.|.:.|:|.|.|:|.:.::|||:..||||.
 Frog   177 KLLNVGFKEAMKDEDWDCLFYHDVDLIPEDDRNIYTCDKFPKHASIAMDKFGYKLPYKSYFGGVS 241

  Fly   223 AINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH---KQEQPNANR 284
            |::..||.::||..|.|:||||||||:..|:....:.|.|.:::..:|.|:||   |..:.|..|
 Frog   242 ALSPEQYMKMNGFPNNYWGWGGEDDDIGIRVALSGMIISRPSIQHGRYKMIKHGHDKGNEQNPKR 306

  Fly   285 VALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            ..:|.........||:|||.|..:.:.:..|:|:|.|:
 Frog   307 FNMLTKTRRTWRQDGMNSLQYLLLSKELQPLYTNITVN 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 82/217 (38%)
b4galt3l2XP_002941069.2 b4GalT 127..344 CDD:132999 82/216 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.