DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt5

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001016385.1 Gene:b4galt5 / 549139 XenbaseID:XB-GENE-982971 Length:384 Species:Xenopus tropicalis


Alignment Length:216 Identity:84/216 - (38%)
Similarity:125/216 - (57%) Gaps:3/216 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRA 158
            |:.||.::|..|..|:..||::|:|.|.|.|.....::...|.:|.:.:..::|||..::|||||
 Frog   143 IQMGGHWKPSDCIPRWKVAILIPFRNRHEHLPVLFKHLIPMLQRQRLQFAFYVVEQAGNQPFNRA 207

  Fly   159 MLFNIG-AQVAAEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFGGVV 222
            ||||:| .:...:..:.|||.||||.:|.:....|.|...|||.::.||.:.:.|||...||||.
 Frog   208 MLFNVGFLEAMKDLDWDCLIFHDVDHIPESDRNYYGCEHMPRHFAAKLDKYMYLLPYNEFFGGVS 272

  Fly   223 AINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTML--KHKQEQPNANRV 285
            .:...|:::|||..|.::|||||||||:.|:|.....:.|...:..||..:  .|:.|.....|.
 Frog   273 GLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQYAGYTVTRPEGDIGKYKSIPHHHRGEVQFLGRY 337

  Fly   286 ALLRSATLRQHADGLNSLVYT 306
            ||||.:..||..||||:|.|:
 Frog   338 ALLRRSKERQTMDGLNNLNYS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 79/202 (39%)
b4galt5NP_001016385.1 b4GalT 157..373 CDD:132999 79/202 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.