DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt6

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001016211.1 Gene:b4galt6 / 548965 XenbaseID:XB-GENE-984613 Length:383 Species:Xenopus tropicalis


Alignment Length:300 Identity:99/300 - (33%)
Similarity:154/300 - (51%) Gaps:27/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YLCLPFRFASHYDYIEESKIEGALVPQVTRNVSQQEVFECTYSEIIAENRFVYHLAHYHDAVQRG 91
            ||...|.|:.|....|:       :|.:....|      ...|||..|:  ||.|:.....::| 
 Frog    96 YLPENFTFSPHLPCPEK-------LPFMRGQTS------VNMSEIGLED--VYQLSSQDTHIER- 144

  Fly    92 AEIRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFN 156
                 ||.::|..|..|:..||::|:|.|.|.|.....::...|.:|.:.:..:::||...:.||
 Frog   145 -----GGHWKPNDCIPRWKVAILIPFRNRHEHLPILFRHLVPMLQKQRLEFAFYVIEQAGTQTFN 204

  Fly   157 RAMLFNIGAQVA-AEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFGG 220
            ||||||||.:.| .:..:.|:|.||||.:|.|....|.|.|.|||.::.||.:.:.|||...|||
 Frog   205 RAMLFNIGFKEAMKDRKWDCVIFHDVDHIPENDRNYYGCGEMPRHFAAKLDKYMYILPYDEFFGG 269

  Fly   221 VVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTML--KHKQEQPNAN 283
            |..:...|:::|||..|.::|||||||||:.|:.....::.|...:..||..:  .|:.|.....
 Frog   270 VSGLTVEQFKKINGFPNAFWGWGGEDDDLWNRVHYAGYNVSRPEGDIGKYKSIPHHHRGEVQFLG 334

  Fly   284 RVALLRSATLRQHADGLNSLVYTE---MERRMHSLFTHIL 320
            |..|||.:..||:.|||::|:|..   :|....::..|::
 Frog   335 RYKLLRYSKERQYLDGLSNLIYAPNIIIEHLYKNITVHLV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 79/218 (36%)
b4galt6NP_001016211.1 b4GalT 156..372 CDD:132999 78/215 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.