DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt4

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001007402.2 Gene:b4galt4 / 492760 ZFINID:ZDB-GENE-041114-103 Length:353 Species:Danio rerio


Alignment Length:346 Identity:103/346 - (29%)
Similarity:163/346 - (47%) Gaps:61/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LITLIVYLCLPFRFAS--------------------HYDYIEESKIEGALVPQVTRNVSQQEVFE 65
            |..|::.||:....|:                    |.:.....::|..:|..:...|.:....|
Zfish    17 LFLLLLCLCVVAWIATFSNDGPVKSVQEGSSPLDGQHAEGFHRLELESEMVQSIEERVEEPPTKE 81

  Fly    66 -C-------------------TYSEIIAENRFVYHLAHYHDAVQRGAEIRPGGEFRPEGCQARYS 110
             |                   |..::..||..|..                 |:::|..|.||.|
Zfish    82 SCPENSPLLRGSLKLTFEPSLTLEQVEIENAEVVE-----------------GQYKPSDCTARQS 129

  Fly   111 TAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIG-AQVAAEYGFP 174
            .||::|:|.||:.|...|.::|.:|.:|.:||.::::.|.....||||.|.|:| .:...:|.:.
Zfish   130 VAILIPHRNREKHLLYLLYHLHPFLQRQQLHYAVYVIHQAGDATFNRAKLLNVGYLEALKDYNWD 194

  Fly   175 CLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSNLY 239
            |.|.|||||:|.|...:|.|:::|:|:....:...::|.|:|.||||.|:...|:.::||..|.|
Zfish   195 CFIFHDVDLVPENDHNLYMCAKQPKHLVVGRNSTGYKLRYKGYFGGVSAMTKDQFHKVNGFPNSY 259

  Fly   240 YGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKHKQE---QPNANRVALLRSATLRQHADGLN 301
            :|||||||||..|:|...:.|.|...|.::|||:.|.::   |.|.:|:.|||........||||
Zfish   260 WGWGGEDDDLRIRVQLQKMAIVRPPPEVARYTMVFHNRDSGNQVNKDRMQLLRRTHQTWKNDGLN 324

  Fly   302 SLVYTEMERRMHSLFTHILVD 322
            |..|..|......|:.::.||
Zfish   325 SCSYKVMSVHRAPLYINVTVD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 82/217 (38%)
b4galt4NP_001007402.2 b4GalT 127..345 CDD:132999 82/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.