DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt7

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_021336677.1 Gene:b4galt7 / 445022 ZFINID:ZDB-GENE-040727-3 Length:328 Species:Danio rerio


Alignment Length:219 Identity:71/219 - (32%)
Similarity:117/219 - (53%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIGAQVA---AE 170
            :..|:|||:|:|.|:|..|:.|||.:|.::.|.::||::.|.||..||||.|.|:|...:   .:
Zfish    94 HKMALIVPFRERFEELLVFVPYMHAFLNKKKIRHKIFIINQVDHFRFNRASLINVGFMESGNDTD 158

  Fly   171 YGFPCLILHDVDLLPLNSGQIYACS-ERPRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQING 234
            |    :.:|||||||.|....|... :.|.|::|...|..:.  |:...||::.:....|...||
Zfish   159 Y----IAMHDVDLLPQNEDLNYGFPVDGPFHVASPELHPLYH--YKTYVGGILLLTKKHYLACNG 217

  Fly   235 MSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH-------KQEQPNANRVALLRSAT 292
            |||.::|||.|||:.:.||:|.|:::.|.....:.....:|       |::|   .|:|..:...
Zfish   218 MSNRFWGWGREDDEFFRRLKAANLELFRPTGITTGTKTFRHIHDPAWRKRDQ---KRIAAQKQEQ 279

  Fly   293 LRQHAD-GLNSLVYTEMERRMHSL 315
            .:...: ||::|.|....|:..|:
Zfish   280 FKVDPEGGLSNLRYKVESRKEVSI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 71/219 (32%)
b4galt7XP_021336677.1 b4GalT 93..316 CDD:132999 71/219 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.