DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and beta4GalT7

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster


Alignment Length:244 Identity:73/244 - (29%)
Similarity:127/244 - (52%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PGGEFRPE----GCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFN 156
            |..|.:|:    |... :..|::||:|.|.|:|..|:.:|..:|.:|.:.:.||::.|.|...||
  Fly    59 PADEKQPQPHDHGASV-HKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFN 122

  Fly   157 RAMLFNIGAQVAAEYGFPCLILHDVDLLPLNSGQI--YACSERPRHMSSALDHWRFRLPYRGLFG 219
            ||.|.|:|.|.|::. :..:.:|||||||||...:  |..|..|.|::....|.::.  |....|
  Fly   123 RASLINVGFQFASDV-YDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYH--YDNFVG 184

  Fly   220 GVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICR-----------FAMEFSKYTML 273
            |::.:....::|:|||||.|:|||.|||:.:.|::...:.:.|           |:...::|.  
  Fly   185 GILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYH-- 247

  Fly   274 KHKQEQPNANRVALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            :.:..|...|:..:.|.   |.|..||:::.|..:  ::|.:    |:|
  Fly   248 RKRDTQKCFNQKEMTRK---RDHKTGLDNVKYKIL--KVHEM----LID 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 68/226 (30%)
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 69/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.