DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and B4galt7

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_008769723.1 Gene:B4galt7 / 364675 RGDID:1309214 Length:381 Species:Rattus norvegicus


Alignment Length:213 Identity:70/213 - (32%)
Similarity:110/213 - (51%) Gaps:29/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 AIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIG---AQVAAEYGF 173
            |::||:|:|.|:|..|:.:||.:|.::.|.:.|:::.|.||..||||.|.|:|   :..:.:|  
  Rat   150 AVLVPFRERFEELLVFVPHMHRFLSRKKIQHHIYVLNQVDHFRFNRAALINVGFLESSNSTDY-- 212

  Fly   174 PCLILHDVDLLPLNSGQIYACSER-PRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSN 237
              :.:|||||||||....|...|. |.|::|...|..:.  |:...||::.::...||..|||||
  Rat   213 --IAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYH--YKTYVGGILLLSKQHYQLCNGMSN 273

  Fly   238 LYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH-----------------KQEQPNANRV 285
            .::|||.|||:.|.|::...:.:.|.....:.|...:|                 ||||...:|.
  Rat   274 RFWGWGREDDEFYRRIKGAGLQLFRPLGITTGYQTFRHLHDPAWRKRDQKRIAAQKQEQFKVDRE 338

  Fly   286 ALLRSATLRQHADGLNSL 303
            ..|.  |:|...|...:|
  Rat   339 GGLN--TVRYRVDSRTAL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 70/213 (33%)
B4galt7XP_008769723.1 b4GalT 146..369 CDD:132999 70/213 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.