DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and B4galt5

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001102078.1 Gene:B4galt5 / 362275 RGDID:1310062 Length:143 Species:Rattus norvegicus


Alignment Length:89 Identity:23/89 - (25%)
Similarity:35/89 - (39%) Gaps:22/89 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FASHYDYIEESKIEGALVPQVTRNVSQQEVFECTYSEIIAENRFVYHLAHYHDAVQRGAEIRPGG 98
            ||:|              |...|..|.:...:...|||        .:...|:...|...||.||
  Rat    65 FANH--------------PCPERLPSMKGPIDINMSEI--------RMDDIHELFSRDPAIRLGG 107

  Fly    99 EFRPEGCQARYSTAIIVPYRQREE 122
            .::|..|..|:..||::|:|.|.:
  Rat   108 HWKPADCMPRWKVAILIPFRNRHD 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 6/15 (40%)
B4galt5NP_001102078.1 Glyco_transf_7N 70..>130 CDD:290452 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3916
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.