DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and B4galt2

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001101435.1 Gene:B4galt2 / 313536 RGDID:1305358 Length:369 Species:Rattus norvegicus


Alignment Length:231 Identity:85/231 - (36%)
Similarity:133/231 - (57%) Gaps:5/231 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLF 161
            ||.:.|..|....:.|:|:|:|.||..|..:|.|:|..|.:|.:.|.::::.|...:.||||.|.
  Rat   128 GGRYSPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLL 192

  Fly   162 NIG--AQVAAEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFGGVVAI 224
            |:|  ..:..:..:.|.|..||||:|::...:|.|.::|||.:.|:|.:.|||||...||||..:
  Rat   193 NVGFLEALKEDATYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGL 257

  Fly   225 NTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH---KQEQPNANRVA 286
            :.||:.:|||..|.|:||||||||::.|:....:.|.|..:...:|.|:||   |..:||..|..
  Rat   258 SKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFN 322

  Fly   287 LLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            .:::..:....||:.|:.|..:|.....|||:|.||
  Rat   323 KIQNTKMSMKWDGIGSVRYRVLEVSRQPLFTNITVD 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 79/218 (36%)
B4galt2NP_001101435.1 b4GalT 142..358 CDD:132999 79/215 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3916
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.