DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and B4galt1

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_445739.1 Gene:B4galt1 / 24390 RGDID:620900 Length:399 Species:Rattus norvegicus


Alignment Length:238 Identity:91/238 - (38%)
Similarity:137/238 - (57%) Gaps:4/238 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QRGAEIRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHK 153
            ::..||:.||.:.|:.|.:.:..|||:|:|.|:|.|..:|.|:|..|.:|.:.|.|:::.|....
  Rat   157 KKNPEIKMGGRYFPKDCISPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDT 221

  Fly   154 PFNRAMLFNIGAQVA-AEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGL 217
            .||||.|.|:|.|.| .:|.:.|.:..||||:|::....|.|..:|||:|.|:|.:.|.|||...
  Rat   222 MFNRAKLLNVGFQEALKDYDYNCFVFSDVDLIPMDDHNAYRCFSQPRHISVAMDKFGFSLPYVQY 286

  Fly   218 FGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH---KQEQ 279
            ||||.|::..|:..|||..|.|:||||||||::.||....:.|.|......:..|::|   |:.:
  Rat   287 FGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVHKGMSISRPNAVVGRCRMIRHSRDKKNE 351

  Fly   280 PNANRVALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            ||..|...:.........||||||.|..::.:.:.|:|.|.||
  Rat   352 PNPQRFDRIAHTKETMRLDGLNSLTYQVLDIQRYPLYTKITVD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 83/217 (38%)
B4galt1NP_445739.1 b4GalT 176..394 CDD:132999 83/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.