DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and B4galt7

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_666157.1 Gene:B4galt7 / 218271 MGIID:2384987 Length:327 Species:Mus musculus


Alignment Length:206 Identity:68/206 - (33%)
Similarity:113/206 - (54%) Gaps:21/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 AIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIG---AQVAAEYGF 173
            |::||:|:|.|:|..|:.:||.:|.::.|.:.|:::.|.||..||||.|.|:|   :..:.:|  
Mouse    96 AVLVPFRERFEELLVFVPHMHRFLSRKRIQHHIYVLNQVDHFRFNRAALINVGFLESSNSTDY-- 158

  Fly   174 PCLILHDVDLLPLNSGQIYACSER-PRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSN 237
              :.:|||||||||....|...|. |.|::|...|..:.  |:...||::.::...||..|||||
Mouse   159 --IAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYH--YKTYVGGILLLSKQHYQLCNGMSN 219

  Fly   238 LYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH-------KQEQPNANRVALLRSATLR- 294
            .::|||.|||:.|.|::...:.:.|.:...:.|...:|       |::|   .|:|..:....: 
Mouse   220 RFWGWGREDDEFYRRIKGAGLQLFRPSGITTGYQTFRHLHDPAWRKRDQ---KRIAAQKQEQFKV 281

  Fly   295 QHADGLNSLVY 305
            ....|||::.|
Mouse   282 DREGGLNTVKY 292

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 68/206 (33%)
B4galt7NP_666157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..88
b4GalT 92..315 CDD:132999 68/206 (33%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 100..104 2/3 (67%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 139..141 1/1 (100%)