DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and bre-4

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_490872.1 Gene:bre-4 / 190668 WormBaseID:WBGene00000269 Length:383 Species:Caenorhabditis elegans


Alignment Length:230 Identity:94/230 - (40%)
Similarity:135/230 - (58%) Gaps:4/230 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLF 161
            ||...|:.|.||:..|||||||.||..|...|..:|:.|.:|.:.|.||:|||..::.|||..|.
 Worm   136 GGHGMPKDCVARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLM 200

  Fly   162 NIGAQVAAE-YGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFGGVVAIN 225
            |:|..||:. |.:.|.|.|||||||.:...:|.|..:|||||.|:|.:.::|||..:|||:.|:.
 Worm   201 NVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFNYKLPYSAIFGGISALT 265

  Fly   226 TAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKHKQEQPN-AN--RVAL 287
            ....::|||.||.::|||||||||..|.....:.:.|:..:.::|.|:||..|..| .|  |..:
 Worm   266 KDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKI 330

  Fly   288 LRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            :.....|...|||::|.|..:...:..|:|..:||
 Worm   331 MGQTKRRWTRDGLSNLKYKLVNLELKPLYTRAVVD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 87/217 (40%)
bre-4NP_490872.1 b4GalT 147..365 CDD:132999 87/217 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3916
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.