DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and sqv-3

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_499164.1 Gene:sqv-3 / 176382 WormBaseID:WBGene00005021 Length:289 Species:Caenorhabditis elegans


Alignment Length:233 Identity:71/233 - (30%)
Similarity:110/233 - (47%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PEGCQARY-STAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIGA 165
            |...|..| ...:|||||.|.|:|..|..:|..:|..|.:.:.|.::.|.|...||||.|.|:|.
 Worm    43 PRPLQTSYHKLCVIVPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQTDPLRFNRASLINVGW 107

  Fly   166 QVAAEYGFPCLILHDVDLLPLNSGQIYACSERP-----RHMSSALDHWRFRLPYRGLFGGVVAIN 225
            ..|...|...::::||||||:|....|   :.|     ||::|...|.::.  |....||::.:.
 Worm   108 NEADRLGCDYMVMNDVDLLPVNPEVPY---DFPGIGVIRHITSPQYHPKYH--YEKFIGGILMLT 167

  Fly   226 TAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICR---FAMEFSK-------------YTMLK 274
            ...|:::|||||.|:|||.|||:.|.|:....:::.|   .:.:.|.             ||..|
 Worm   168 LKDYKKLNGMSNKYWGWGLEDDEFYLRIIDSKLNLTRVSGLSTDSSNTFRHIHGPKRKRDYTPKK 232

  Fly   275 HKQEQPNANRVALLRSATLRQHADGLNSLVYTEMERRM 312
            :.:.|....|        .|.|..||:.:.|....|::
 Worm   233 NDKNQWEIKR--------KRDHVSGLHDVRYLIDSRQL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 69/227 (30%)
sqv-3NP_499164.1 b4GalT 50..278 CDD:132999 69/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.