DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt2

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002931518.2 Gene:b4galt2 / 100492356 XenbaseID:XB-GENE-997913 Length:374 Species:Xenopus tropicalis


Alignment Length:242 Identity:95/242 - (39%)
Similarity:142/242 - (58%) Gaps:5/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DAVQR-GAEIRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQ 149
            :.||| ..::..||.:.|..||.:...|||:|:|.||..|..:|.|:|..|.:|.:.|.|:::.|
 Frog   122 ERVQRENPDVTEGGRYTPPDCQPKEKVAIIIPFRHREHHLKYWLHYLHPILRRQKVAYGIYIINQ 186

  Fly   150 FDHKPFNRAMLFNIG-AQVAAEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLP 213
            |....||||.|.|:| .:...|..:.|.|..||||:|::...:|.|.|:|||.:.|:|.:.||||
 Frog   187 FGEDTFNRAKLLNVGFLEAMKEADYDCFIFSDVDLIPMDDRNLYHCYEQPRHFAIAMDKFGFRLP 251

  Fly   214 YRGLFGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH--- 275
            |.|.||||..::.||:.:|||..|.|:||||||||:|.|:....:.|.|..:...:|.|:||   
 Frog   252 YAGYFGGVSGLSKAQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKISRPDIRIGRYRMIKHERD 316

  Fly   276 KQEQPNANRVALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            |..:||..|...:::..:....||:|||.|..:....:.::|:|.||
 Frog   317 KHNEPNPQRFTKIQNTKMTMKKDGINSLHYRVIHSAKYPMYTNITVD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 85/217 (39%)
b4galt2XP_002931518.2 b4GalT 145..363 CDD:132999 85/217 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.