DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt3

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_031747171.1 Gene:b4galt3 / 100486704 XenbaseID:XB-GENE-22252019 Length:467 Species:Xenopus tropicalis


Alignment Length:231 Identity:99/231 - (42%)
Similarity:143/231 - (61%) Gaps:5/231 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLF 161
            |||::|..|:||:.||||:|:|.||..|...|.|:|.:|.:|.:||||:::.|..:..||||.|.
 Frog   112 GGEYKPPNCEARHRTAIIIPHRNRETHLRHLLYYLHPFLQRQQLHYRIYIINQAGNATFNRAKLL 176

  Fly   162 NIGAQVA-AEYGFPCLILHDVDLLPLNSGQIYACSE-RPRHMSSALDHWRFRLPYRGLFGGVVAI 224
            |:|.:.| .:..:.||.||||||:|.|...:|.|.. .|:|.|.|::.:.:.|||...||||.|:
 Frog   177 NVGVKEALRDEEWDCLFLHDVDLIPENDYNLYVCDPWNPKHASVAMNKFSYSLPYPQYFGGVSAL 241

  Fly   225 NTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKHKQEQ---PNANRVA 286
            ...||.::||..|.|:||||||||:..|::...:.|.|.::....|.|:|||.:|   .|.:|..
 Frog   242 TPDQYMKMNGFPNEYWGWGGEDDDIATRVRLAGMKITRPSVSVGHYKMVKHKVDQGNEENPHRFD 306

  Fly   287 LLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            ||........|||:|||.||.:||.:..|:|::.||
 Frog   307 LLIRTQRMWKADGMNSLTYTLLERALEPLYTNVTVD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 91/218 (42%)
b4galt3XP_031747171.1 b4GalT 123..342 CDD:132999 91/218 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.