DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt1l

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002937991.3 Gene:b4galt1l / 100485024 XenbaseID:XB-GENE-22169400 Length:371 Species:Xenopus tropicalis


Alignment Length:251 Identity:98/251 - (39%)
Similarity:156/251 - (62%) Gaps:5/251 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RFVYHLAHYHDAVQRGAEIRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLI 140
            :|.|::: ....:.:...::|||..||:.|.|....|||:|:|.||..|..:|.|||.:|.||..
 Frog   103 KFAYNMS-LLKIISQNPNLQPGGHSRPKYCTALQKIAIIIPFRNRESHLRTWLYYMHPFLQQQQA 166

  Fly   141 HYRIFLVEQFDHKPFNRAMLFNIGAQVA-AEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSA 204
            .|.:::|||.:...||||.|.|:|..|| .:|.:.|.|..|||::|::...::.||:.||||:::
 Frog   167 DYGVYVVEQTEDTLFNRAKLMNVGYSVAIKDYNYTCFIFTDVDIIPMDGRNLFRCSDNPRHMANS 231

  Fly   205 LDHWRFRLPYRGLFGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSK 269
            :|.:.|:|||..:|||:||....|:.::||.||:::|||||||:|::|:.|:.:.:.|.....::
 Frog   232 VDKFNFKLPYNDIFGGIVAFTKEQFIKVNGFSNVFWGWGGEDDELFQRVVAMGMKVERPDQTIAR 296

  Fly   270 YTMLKHKQEQPN---ANRVALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
            ..|:.||::..|   .....|::.|..|.|.||||||:||.:....|.|:|.|.||
 Frog   297 SKMISHKRDPGNESTGKSFHLIKKAHERLHKDGLNSLIYTIISITSHKLYTKITVD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 87/217 (40%)
b4galt1lXP_002937991.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122759
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 1 1.000 - - FOG0014428
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.