DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt2

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001121857.1 Gene:b4galt2 / 100148828 ZFINID:ZDB-GENE-070912-258 Length:379 Species:Danio rerio


Alignment Length:244 Identity:92/244 - (37%)
Similarity:143/244 - (58%) Gaps:9/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DAVQR-GAEIRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQ 149
            :.||| ...:..||::.|..|:.:...|||:|:|.|:..|..:|.|:|..|.:|.|.|.|:::.|
Zfish   127 ERVQRENPNVTEGGKYTPPDCRPKQKVAIIIPFRHRDNHLKYWLHYLHPVLRRQKIDYGIYIINQ 191

  Fly   150 FDHKPFNRAMLFNIGAQVA---AEYGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFR 211
            .....||||.|.|:|...|   |||.  |.|..||||:|::...:|.|.::|||.:.|:|.:.||
Zfish   192 LGEDTFNRAKLLNVGYTEAIKDAEYN--CFIFSDVDLIPMDDRNLYHCYDQPRHFAIAMDKFGFR 254

  Fly   212 LPYRGLFGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH- 275
            |||.|.||||..::..|:.:|||..|.|:||||||||:|.|:....:.:.|..:...:|.|:|| 
Zfish   255 LPYAGYFGGVSGLSKKQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKVSRPDVRIGRYRMIKHE 319

  Fly   276 --KQEQPNANRVALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322
              |..:||..|.:.:::.......||::||:|..:..:.:.|:|:|.|:
Zfish   320 RDKHNEPNPQRFSKIQNTKNTMRKDGISSLMYRVVSIKKYPLYTNISVE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 84/219 (38%)
b4galt2NP_001121857.1 b4GalT 150..368 CDD:132999 84/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3916
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.