DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt7

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001120017.1 Gene:b4galt7 / 100144979 XenbaseID:XB-GENE-973272 Length:322 Species:Xenopus tropicalis


Alignment Length:204 Identity:70/204 - (34%)
Similarity:112/204 - (54%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 AIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIG-AQVAAEYGFPC 175
            |::||:|:|.|:|.:|:.:||.||.|:.|.:.||::.|.||..||||.|.|:| .:...|..:  
 Frog    91 ALLVPFRERFEELMSFVPHMHQYLLQKKILHHIFIINQVDHYRFNRASLINVGFLESGNETDY-- 153

  Fly   176 LILHDVDLLPLNSGQIYACSER-PRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSNLY 239
            :.:|||||||||....|...|: |.|::|...|..:.  |:...||::.:....|:..|||||.:
 Frog   154 IAMHDVDLLPLNLDLDYGFPEKGPFHVASPELHPLYH--YKTYVGGILMLTKQHYEMCNGMSNRF 216

  Fly   240 YGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKH-------KQEQPNANRVALLRSATLR-QH 296
            :|||.|||:.|.|::...:.:.|.....:.|...:|       |::|   .|:|..:....: ..
 Frog   217 WGWGREDDEFYRRIKGAGLQLFRPTGISTGYKTFRHIHDPAWRKRDQ---KRIAAQKQEQFKVDR 278

  Fly   297 ADGLNSLVY 305
            ..||:|:.|
 Frog   279 EGGLHSVKY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 70/204 (34%)
b4galt7NP_001120017.1 b4GalT 87..310 CDD:132999 70/204 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.