DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and SS2

DIOPT Version :9

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_177542.1 Gene:SS2 / 843740 AraportID:AT1G74020 Length:335 Species:Arabidopsis thaliana


Alignment Length:348 Identity:77/348 - (22%)
Similarity:138/348 - (39%) Gaps:90/348 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 YTGIHSGEVIRLNNEESVQPITKIGQP-----CDYIFDDEL---CGYPVGLALDTQGNNLIVSDA 137
            |||:..|::::...|.......:|.:.     ||......|   ||.|.|:|.:.:..:|.|:||
plant    52 YTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGTIGTALAGRCGRPAGIAFNEKTGDLYVADA 116

  Fly   138 YYGIWQVD----LETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQGDIFWTDSFSEDF---- 194
            ..|:..:.    |.||       ....:.||    ..|..:.|.:.....:.:..|||..|    
plant   117 PLGLHVISPAGGLATK-------ITDSVDGK----PFKFLDGLDVDPTTGVVYFTSFSSRFSPIQ 170

  Fly   195 --VFAAFANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYLKGSR 257
              :.....:.:|:|::||...|...||::.||.:.|.|:|....|:::::.|...::||::||.:
plant   171 VLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGPK 235

  Fly   258 AGESEVFVEGLPGCPDNL--TADEEGIWVPLSVASDSQNPNLFAVLAPYPRLRSFLARLVALMRL 320
            ||.||.|...:.. |||:  .......||...|                                
plant   236 AGSSEDFTNSVSN-PDNIKRIGSTGNFWVASVV-------------------------------- 267

  Fly   321 PLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLHGFDRSASG-ISHVLEV 384
                                 |.:::   |...:.|:|:.||.:::::...|:.... :|.|.|.
plant   268 ---------------------NKIIV---PTNPSAVKVNSNGEVLQTIPLKDKFGDTLLSEVNEF 308

  Fly   385 KGHLYLGSPFNHYVAKVKLPEEG 407
            :|:||:|:....:...:|| |:|
plant   309 EGNLYIGTLTGPFAGILKL-EKG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 56/222 (25%)
Str_synth 174..256 CDD:304606 22/87 (25%)
SS2NP_177542.1 YvrE 44..293 CDD:225921 65/308 (21%)
Str_synth 146..234 CDD:281131 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4480
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X608
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.