DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and LAP3

DIOPT Version :10

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_191512.1 Gene:LAP3 / 825122 AraportID:AT3G59530 Length:403 Species:Arabidopsis thaliana


Alignment Length:120 Identity:24/120 - (20%)
Similarity:48/120 - (40%) Gaps:31/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 CKV-LAGNEEALRFLE--ANAKR---FNIRRIKRLPVSGAFHTE--------LMQPAVEPFAAAL 308
            ||. :|.|:.::.|.|  .|.|.   ..|..||:..:..|...|        :.:.|::.:...|
plant    16 CKCWIADNKPSIEFHERGKNHKENVTKKISEIKKKSMDKAKEDEKKSKEFAAMEEAALKAYEEDL 80

  Fly   309 KKIRVEDPIISVHSNVDGKCYKSAGHIVGQLPKQIVRPVKWE--QTLHIMYERKQ 361
            |:::.:.|:             ..|..|.|:..:  ...||:  :.:..::.:||
plant    81 KRLQGDVPV-------------PVGPTVQQIKAR--NENKWKEIEAIERVHAKKQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 61..>284 CDD:442613 9/31 (29%)
LAP3NP_191512.1 SSL_N <75..109 CDD:437899 8/48 (17%)
YvrE 150..>315 CDD:442613
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.