DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and YLS2

DIOPT Version :9

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_566951.1 Gene:YLS2 / 824306 AraportID:AT3G51430 Length:371 Species:Arabidopsis thaliana


Alignment Length:416 Identity:115/416 - (27%)
Similarity:186/416 - (44%) Gaps:82/416 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TSLFLVLF-LGSLFLLPVLYPSTTF-----PFEQY-----FIKPARDLNGTLELNNHLNGARKLW 63
            :|.||..| :..|.:...||...||     |.|.|     .|.|       |..:.:|.||..:.
plant     6 SSRFLFFFTIVPLLVSIALYQLDTFDPAPVPSEAYASSTTSIPP-------LISDKYLTGAEFIG 63

  Fly    64 KDQIFGPECLIVLEDK--IYTGIHSGEVIRLNNEESVQPITKIGQPCDYIFDD--ELCGYPVGLA 124
            ...:..||.:...:|.  ||||...|.|.|::..:|..         |.:.:|  ...|.|:|:|
plant    64 VGLLDKPEDIAYHQDSNLIYTGCIDGWVKRVSVHDSAN---------DSVVEDWVNTGGRPLGIA 119

  Fly   125 LDTQGNNLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQGDIFWTD- 188
            ....| .:||:|||.|:..:..:.||       .::|..:....:.||.:.:.::..|.:::|| 
plant   120 FGVHG-EVIVADAYKGLLNISGDGKK-------TELLTDQAEGVKFKLTDVVAVADNGVLYFTDA 176

  Fly   189 SFSEDFVFAAF----ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLR 249
            |:........|    ..|.|||..:|...:...|||.:|.||||:::||.:..:|..||...|..
plant   177 SYKYTLHQVKFDILEGKPHGRLMSFDPTTRVTRVLLKDLYFANGVSMSPDQTHLIFCETPMRRCS 241

  Fly   250 RYYLKGSRAGESEVFVEGLPGCPDNLTADEEG-IWVPL-SVASDSQNPNLFAVLAPYPRLRSFLA 312
            :||:...|.   |||::||||.|||:..|.:| .|:.: |.||     .|:.:...||.||...|
plant   242 KYYINEERV---EVFIQGLPGYPDNIRYDGDGHYWIAMVSGAS-----TLWRLSMKYPFLRKITA 298

  Fly   313 RLVALMRLPLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLHGFDRSASG 377
                                |||:  :....:.::||    .|::||.:||.:...|  |:..|.
plant   299 --------------------IAAK--YGVELMFMKNA----GVLQVDLDGNPIAYYH--DQRLSH 335

  Fly   378 ISHVLEVKGHLYLGSPFNHYVAKVKL 403
            |:..:::..:||.|:..:.|:.::.|
plant   336 ITTGIKIGNYLYCGNILHSYIIRLDL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 65/211 (31%)
Str_synth 174..256 CDD:304606 26/86 (30%)
YLS2NP_566951.1 YvrE 70..299 CDD:225921 78/273 (29%)
Str_synth 161..248 CDD:281131 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3710
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1870
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3471
orthoMCL 1 0.900 - - OOG6_101875
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.