DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and SSL4

DIOPT Version :9

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_190710.1 Gene:SSL4 / 824305 AraportID:AT3G51420 Length:370 Species:Arabidopsis thaliana


Alignment Length:418 Identity:113/418 - (27%)
Similarity:188/418 - (44%) Gaps:85/418 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVLFLGSLFL-----LPVLYPSTTFPFEQYFIKPARDLNGTL---------ELNNH-LNGARKLW 63
            :|||..:.||     .|.|...|.:..:.:  :||.....:|         .||:. |.||..:.
plant     1 MVLFFSTRFLFFSIFFPCLISITLYQLDSF--EPASLPADSLITSPTSIPPLLNDRFLTGAEFIG 63

  Fly    64 KDQIFGPECLIVLEDK--IYTGIHSGEVIRLNNEESVQPITKIGQPCDYIFDD--ELCGYPVGLA 124
            ...:..||.:...:|.  ||||...|.|.|::..:|..         |.|.:|  ...|.|:|:|
plant    64 VGLLNNPEDIAYHKDSNLIYTGCVDGWVKRVSVHDSAN---------DSIVEDWVNTGGRPLGIA 119

  Fly   125 LDTQGNNLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQGDIFWTDS 189
            ....| .:||:||..|:..:. :..|||      ::|..:....|.||.:::.::..|.:::||:
plant   120 FGLHG-EVIVADANKGLLSIS-DGGKKT------ELLTDEADGVRFKLTDAVTVADNGVLYFTDA 176

  Fly   190 FSE----DFVFAAF-ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLR 249
            .|:    .|:|... ..|.||:..:|...:...|||.:|.||||:::||.:...:..||...|..
plant   177 SSKYDFYQFIFDFLEGKPHGRVMSFDPTTRATRVLLKDLYFANGISMSPDQTHFVFCETIMRRCS 241

  Fly   250 RYYLKGSRAGESEVFVEGLPGCPDNLTADEEG-IWVPLSVASDSQNPNLFAVLAPYPRLRSFLAR 313
            :||:...|.   |||::||||.|||:..|.:| .|:.|                        ::.
plant   242 KYYISEERV---EVFIQGLPGYPDNIRYDGDGHYWIAL------------------------ISE 279

  Fly   314 LVALMRLPLRVL---NHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLHGFDRSA 375
            :....:|.::.|   ..||   :||:  :....|.|:||    .|::||.:||.:...|  |...
plant   280 VTTSWKLSMKYLFLRKLIY---MAAK--YGVELLSIKNA----AVLQVDLDGNPIAMYH--DHPF 333

  Fly   376 SGISHVLEVKGHLYLGSPFNHYVAKVKL 403
            |.|:..:::..|||.||..:.|:.::.|
plant   334 SHITSGVKIGNHLYFGSLLHSYITRLDL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 66/211 (31%)
Str_synth 174..256 CDD:304606 25/86 (29%)
SSL4NP_190710.1 YvrE 70..>278 CDD:225921 71/251 (28%)
Str_synth 161..248 CDD:281131 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3710
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1870
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101875
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.