DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and SSL2

DIOPT Version :9

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_181661.1 Gene:SSL2 / 818728 AraportID:AT2G41290 Length:376 Species:Arabidopsis thaliana


Alignment Length:355 Identity:103/355 - (29%)
Similarity:167/355 - (47%) Gaps:64/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GPECLI--VLEDKIYTGIHSGEVIR-LNNEE-----SVQPITKIG--QPCDYIFDDELCGYPVGL 123
            |||..:  ...|..|||:..|.::: |.||.     :|....:.|  .|.::...:.:||.|:||
plant    51 GPESFVFDFFGDGPYTGLSDGRIVKWLANESRWIDFAVTTSAREGCEGPHEHQRTEHVCGRPLGL 115

  Fly   124 ALDTQGNNLIVSDAYYGIWQVDLETKKKTVLVP----AEQILPGKGANRRAKLFNSLVIS-RQGD 183
            |.|....:|.::|||.|:.:|.          |    |.|:|| :..|...:..|||.|: |.|.
plant   116 AFDKSTGDLYIADAYMGLLKVG----------PTGGVATQVLP-RELNEALRFTNSLDINPRTGV 169

  Fly   184 IFWTDSFS----EDFVFAAFA-NPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAET 243
            :::|||.|    .:::.|..: :.:|||.:||..|:.. .||..|:|.||:|||.:.|::::.||
plant   170 VYFTDSSSVYQRRNYIGAMMSGDKTGRLMKYDNTKQVT-TLLSNLAFVNGVALSQNGDYLLVVET 233

  Fly   244 TAMRLRRYYL-----KGSRAGESEVFVEGLPGCPDNL-TADEEGIWVPLSVASDSQNPNLFAVLA 302
            ...|:.||:|     |.......|:|.|||||.|||: .:...|.||.|:.....        |.
plant   234 AMCRILRYWLNETSVKSQSHDNYEIFAEGLPGFPDNIKRSPRGGFWVGLNTKHSK--------LT 290

  Fly   303 PYPRLRSFLARLVALMRLPLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRS 367
            .:....::|.|  |.:.||   ::.:..:.:.||  ::.|.:.:|.:.....::.|....|    
plant   291 KFAMSNAWLGR--AALGLP---VDWMKVHSVWAR--YNGNGMAVRLSEDSGVILEVFEGKN---- 344

  Fly   368 LHGFDRSASGISHVLEVKGHLYLGS---PF 394
                :.....||.|.|..|.|::||   ||
plant   345 ----ENKWISISEVEEKDGTLWVGSVNTPF 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 74/227 (33%)
Str_synth 174..256 CDD:304606 34/92 (37%)
SSL2NP_181661.1 YvrE 30..>293 CDD:225921 82/261 (31%)
Str_synth 159..246 CDD:281131 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3710
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1870
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 1 1.000 - - FOG0001350
OrthoInspector 1 1.000 - - otm3471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X608
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.