DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssl2 and APMAP

DIOPT Version :9

Sequence 1:NP_651656.2 Gene:Ssl2 / 43424 FlyBaseID:FBgn0041780 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_065392.1 Gene:APMAP / 57136 HGNCID:13238 Length:416 Species:Homo sapiens


Alignment Length:406 Identity:129/406 - (31%)
Similarity:211/406 - (51%) Gaps:46/406 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLKTSLFLVLFLGSLFLLPVLYPSTTFPFEQYFIKPARDLNGTLELNNHLNGARKLWKDQIFGPE 71
            :|..||.:.| ||::.||    .|...|....|.:|.. |.|.|..|..|..|.:|:::|:.|||
Human    45 MLAVSLTVPL-LGAMMLL----ESPIDPQPLSFKEPPL-LLGVLHPNTKLRQAERLFENQLVGPE 103

  Fly    72 CLIVLEDKIYTGIHSGEVIRLNNEESVQPITKIGQ-PCDYIFDDELCGYPVGLALDTQGNNLIVS 135
            .:..:.|.::||...|.|::|.|.| ::.|.:.|. ||....|:.:||.|:|:.....| .|.|:
Human   104 SIAHIGDVMFTGTADGRVVKLENGE-IETIARFGSGPCKTRDDEPVCGRPLGIRAGPNG-TLFVA 166

  Fly   136 DAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQG-DIFWTDSFSE----DFV 195
            |||.|:::|:...::..:|:.:|..:.||..:    ..|.|.:::.| .|::|||.|:    |::
Human   167 DAYKGLFEVNPWKREVKLLLSSETPIEGKNMS----FVNDLTVTQDGRKIYFTDSSSKWQRRDYL 227

  Fly   196 FAAF-ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYLKGSRAG 259
            .... ....|||..||.|.:..:||||:|.|.||:.|||:|||:::||||..|:||.|:.|...|
Human   228 LLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKG 292

  Fly   260 ESEVFVEGLPGCPDNL-TADEEGIWVPLSVASDSQNPNLFAVLAPYPRLRSFLARLVALMRLPLR 323
            .:::|||.:||.|||: .:...|.||.:|....:...::...|:..|.::..:.:|.:       
Human   293 GADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFS------- 350

  Fly   324 VLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDWNGNIVRSLHGFD-RSASGISHVLEVKGH 387
                              .:.|::..|:.|.|:.:..:|...||||..| ..|:.||.|.|..||
Human   351 ------------------QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGH 397

  Fly   388 LYLGSPFNHYVAKVKL 403
            |||||..:.::.::.|
Human   398 LYLGSFRSPFLCRLSL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssl2NP_651656.2 YvrE 80..>284 CDD:225921 76/211 (36%)
Str_synth 174..256 CDD:304606 37/87 (43%)
APMAPNP_065392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
YvrE 73..>320 CDD:225921 91/253 (36%)
NHL 96..>284 CDD:302697 68/193 (35%)
NHL repeat 102..137 CDD:271320 11/35 (31%)
NHL repeat 152..193 CDD:271320 12/41 (29%)
NHL repeat 200..252 CDD:271320 15/51 (29%)
Str_synth 201..288 CDD:304606 37/86 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160327
Domainoid 1 1.000 77 1.000 Domainoid score I8871
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I4069
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48544
OrthoDB 1 1.010 - - D336287at33208
OrthoFinder 1 1.000 - - FOG0001350
OrthoInspector 1 1.000 - - otm40608
orthoMCL 1 0.900 - - OOG6_101875
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3581
SonicParanoid 1 1.000 - - X608
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.