DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and EIF4E2

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_004837.1 Gene:EIF4E2 / 9470 HGNCID:3293 Length:245 Species:Homo sapiens


Alignment Length:177 Identity:61/177 - (34%)
Similarity:93/177 - (52%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QTKESSEFKMG----TSLDNNKLAS-----LGATNKHRLQNTWTLWGVKYDP-----EISWEDML 56
            |.:|:|..|.|    |..|.|:.:|     :....:|.||..:|.|..:..|     ..|:|..:
Human    18 QNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNI 82

  Fly    57 KEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAEL 121
            |:|.:|.:||.||..|..:..|..|....|:.|||:||:|||||..||.||:|..::.|...:  
Human    83 KQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLAS-- 145

  Fly   122 DKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGDE 168
             :.|.:::|.|:||.....::||||.|.:|...:.||:|.|. |.|:
Human   146 -RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKT-ASDQ 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 48/135 (36%)
EIF4E2NP_004837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 9/33 (27%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000269|PubMed:17368478 54..57 1/2 (50%)
IF4E 55..214 CDD:396291 51/140 (36%)