DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and CDC33

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_014502.1 Gene:CDC33 / 854026 SGDID:S000005499 Length:213 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:62/165 - (37%)
Similarity:90/165 - (54%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSEFKMGTSLDNNKLA-------SLGATNKHRLQNTWTLWGVK--YDPEISWEDMLKEIDSFNTV 65
            |.:|:...|:|:....       |.....||.|...||||..|  .|...||.|:|:.:.||.||
Yeast     7 SKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTV 71

  Fly    66 EDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLL 130
            |:||.:...|..|.:|....||.:|:..:||.|||..|..||:|:::: :...|::|:.||..||
Yeast    72 EEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQL-RGKGADIDELWLRTLL 135

  Fly   131 CMIGEACDHCD-QICGAFVRIRKNINKISVWTKAD 164
            .:|||..|..| ||.|..:.|||..||.::|||::
Yeast   136 AVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 54/131 (41%)
CDC33NP_014502.1 CDC33 1..213 CDD:227386 62/165 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346523
Domainoid 1 1.000 139 1.000 Domainoid score I1034
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1143
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - otm46506
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.