DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and AT1G29550

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_174248.1 Gene:AT1G29550 / 839832 AraportID:AT1G29550 Length:240 Species:Arabidopsis thaliana


Alignment Length:161 Identity:59/161 - (36%)
Similarity:84/161 - (52%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SLDNNKLASLGAT----NKHRLQNTWTLWGVKYD------PEISWEDMLKEIDSFNTVEDFWNLY 72
            |.:....||..:|    ..|..||:||.|   :|      .::.|...|:.:.:|.|:|:||:||
plant    46 SKEKKNYASKKSTTVIQKSHCFQNSWTFW---FDNPSSKSNQVIWGSSLRSLYTFGTIEEFWSLY 107

  Fly    73 FRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEAC 137
            ..|..|:|...|.|...||..|.|.||||....||:|:....|   |.|:..||:.||.::||..
plant   108 NNIHPPTKWVSGADLYCFKDKIEPKWEDPICANGGKWSMMFPK---ATLECNWLNTLLALVGEQF 169

  Fly   138 DHCDQICGAFVRIRKNINKISVWTKADAGDE 168
            |..|:||||.:..|...::||:|||..|.:|
plant   170 DQGDEICGAVLNFRARGDRISLWTKNAANEE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 52/136 (38%)
AT1G29550NP_174248.1 IF4E 67..221 CDD:396291 54/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.