DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and LSP1

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001332369.1 Gene:LSP1 / 833534 AraportID:AT5G35620 Length:198 Species:Arabidopsis thaliana


Alignment Length:166 Identity:62/166 - (37%)
Similarity:88/166 - (53%) Gaps:16/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MGTSLDNNKL---ASLGAT----NKHRLQNTWTLWGVKYDPE----ISWEDMLKEIDSFNTVEDF 68
            |.|...|..|   |.|.||    ..|:|:..|:.|   :|.:    .:|...|::..:|:|||||
plant     1 MATDDVNEPLPAAAELPATEAEKQPHKLERKWSFW---FDNQSKKGAAWGASLRKAYTFDTVEDF 62

  Fly    69 WNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMI 133
            |.|:..|...|||....:..|||.|:.|.||||....||:||:.|.......|||.||:.|:.:|
plant    63 WGLHETIFQTSKLTANAEIHLFKAGVEPKWEDPECANGGKWTWVVTANRKEALDKGWLETLMALI 127

  Fly   134 GEACDHCDQICG--AFVRIRKNINKISVWTKADAGD 167
            ||..|..|:|||  |.||.:...:|:|:||:..:.:
plant   128 GEQFDEADEICGVVASVRPQSKQDKLSLWTRTKSNE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 52/137 (38%)
LSP1NP_001332369.1 IF4E 27..185 CDD:396291 53/140 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.