DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and NCBP

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_197312.1 Gene:NCBP / 831929 AraportID:AT5G18110 Length:221 Species:Arabidopsis thaliana


Alignment Length:169 Identity:56/169 - (33%)
Similarity:87/169 - (51%) Gaps:22/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ENLRQTKESSEFKMGTSLDNNKLASLGATNKHRLQNTWTLWGVKYDPEI---SWEDMLKEIDSFN 63
            :::.:.:.|.|.|.|               .|.|:..:::|..:..|.:   |:||.:|::..|:
plant    27 DSVSEERRSRELKDG---------------DHPLRYKFSIWYTRRTPGVRNQSYEDNIKKMVEFS 76

  Fly    64 TVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLDV 128
            |||.||..|..:...|.|....|...||.||||:|||..|..||:|..:..|..:|   :.|.|:
plant    77 TVEGFWACYCHLARSSLLPSPTDLHFFKDGIRPLWEDGANCNGGKWIIRFSKVVSA---RFWEDL 138

  Fly   129 LLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGD 167
            ||.::|:..|..|.||||.:.:|.|.:.||||.: :|.|
plant   139 LLALVGDQLDDADNICGAVLSVRFNEDIISVWNR-NASD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 50/134 (37%)
NCBPNP_197312.1 IF4E 44..201 CDD:366742 51/137 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.