DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and EIF4E

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_193538.1 Gene:EIF4E / 827529 AraportID:AT4G18040 Length:235 Species:Arabidopsis thaliana


Alignment Length:165 Identity:68/165 - (41%)
Similarity:92/165 - (55%) Gaps:10/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESSEFKMGTSLDN-NKLASLGATNKHRLQNTWTLW----GVKYDPEISWEDMLKEIDSFNTVEDF 68
            |..|...|....| ::.:..|....|.|:::||.|    .|| ..:.||...|:.:.:|:|||:|
plant    35 EEGEIAGGEGDGNVDESSKSGVPESHPLEHSWTFWFDNPAVK-SKQTSWGSSLRPVFTFSTVEEF 98

  Fly    69 WNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMI 133
            |:||..:..||||..|.|:..||..|.|.||||....||:||....|..:   ||:||..||.:|
plant    99 WSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTFPKEKS---DKSWLYTLLALI 160

  Fly   134 GEACDHCDQICGAFVRIRKNINKISVWTKADAGDE 168
            ||..||.|:||||.|.||....:||:||| :|.:|
plant   161 GEQFDHGDEICGAVVNIRGKQERISIWTK-NASNE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 60/134 (45%)
EIF4ENP_193538.1 IF4E 61..216 CDD:396291 62/139 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.