DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_038952114.1 Gene:Eif4e1b / 686104 RGDID:1585494 Length:263 Species:Rattus norvegicus


Alignment Length:161 Identity:67/161 - (41%)
Similarity:96/161 - (59%) Gaps:11/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLRQTKESSEFKMGTSLDNNKLASLGATNKHRLQNTWTLWGVKYDPEISWEDMLKEIDSFNTVED 67
            :|:..|:.::.:..|.|..         ..|.||..|.||..|.|...:|:|.|:.:..|:||||
  Rat    62 SLKTVKQKAQREHPTKLPR---------ELHPLQFRWVLWFFKNDRSRAWQDNLQLVTKFDTVED 117

  Fly    68 FWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRST-AELDKTWLDVLLC 131
            ||..|..:...|||:.||||.|||:||:|||||..||.||||...:.|:.. .|||:.||:.|||
  Rat   118 FWATYRHVKLASKLSCGCDYALFKEGIQPMWEDSRNKRGGRWLLSLAKQQRHMELDRLWLETLLC 182

  Fly   132 MIGEAC-DHCDQICGAFVRIRKNINKISVWT 161
            ::||:. ::..::|||.|.||...:||::||
  Rat   183 LLGESFEEYSGEVCGAVVNIRTKGDKIALWT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 60/127 (47%)
Eif4e1bXP_038952114.1 IF4E 84..243 CDD:396291 62/130 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.