DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eif4e3

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001016049.1 Gene:eif4e3 / 548803 XenbaseID:XB-GENE-992071 Length:218 Species:Xenopus tropicalis


Alignment Length:133 Identity:41/133 - (30%)
Similarity:65/133 - (48%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LQNTWTLWGVKYDP---EISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRP 96
            |.:.||.|..:..|   ....|..||:|.:.:|::.||::|..|...:.|.....|.|.:...:|
 Frog    43 LHSPWTFWLDRSLPGTTAAECESNLKKIYTVHTIQSFWSVYNNIPQVTNLPLRWSYHLMRGERKP 107

  Fly    97 MWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEA-CDHC---DQICGAFVRIRKNINKI 157
            :||:..|..||.|..||.|.:::   ..|.::||..|||. .|.|   |::.|..|.:|...:.:
 Frog   108 LWEEESNAKGGVWKMKVPKEASS---LVWKELLLATIGEQFTDRCAPEDEVIGVSVSVRDREDVV 169

  Fly   158 SVW 160
            .||
 Frog   170 QVW 172

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 40/131 (31%)
eif4e3NP_001016049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
IF4E 45..198 CDD:279921 40/131 (31%)