DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eif4e2

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001014815.2 Gene:eif4e2 / 541523 ZFINID:ZDB-GENE-050327-59 Length:236 Species:Danio rerio


Alignment Length:172 Identity:58/172 - (33%)
Similarity:90/172 - (52%) Gaps:17/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ENLRQTKESSEFKMGTSLDNNKLASLGATNKHRLQNTWTLWGVKYDP-----EISWEDMLKEIDS 61
            :|..:.||::..|        :.|.:....:|.||..:|.|..:..|     ..|:|..:|:|.|
Zfish    30 KNDEEDKEANTTK--------RKAVVPGAGEHPLQYNYTFWYSRRTPGRPASTQSYEQNIKQIGS 86

  Fly    62 FNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWL 126
            |.:||.||..|..:..|..|....|:.|||:||:|||||..||.||:|..::.|...:   :.|.
Zfish    87 FASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIIRLRKGLAS---RCWE 148

  Fly   127 DVLLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGDE 168
            :::|.|:||.....::||||.|.:|...:.||:|.|. |.|:
Zfish   149 NLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKT-ASDQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 49/135 (36%)
eif4e2NP_001014815.2 IF4E 54..212 CDD:307672 52/140 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.660

Return to query results.
Submit another query.