DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eif4eb

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001007778.1 Gene:eif4eb / 493617 ZFINID:ZDB-GENE-041121-14 Length:216 Species:Danio rerio


Alignment Length:149 Identity:73/149 - (48%)
Similarity:94/149 - (63%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NNKLASLGATNKHRLQNTWTLWGVKYDPEISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGC 85
            |.::.|..:..||.|||.|.||..|.|...:|:..|:.|..|:||||||.||..|...|.|..||
Zfish    24 NQEIVSPESYIKHPLQNRWCLWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGC 88

  Fly    86 DYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTA-ELDKTWLDVLLCMIGEAC-DHCDQICGAFV 148
            ||.|||.||.|||||..||.||||...::|:... :||:.||:.|||:||||. |:.|.:|||.|
Zfish    89 DYSLFKDGIEPMWEDERNKRGGRWLITLNKQQRKYDLDRFWLETLLCLIGEAFDDYSDDVCGAVV 153

  Fly   149 RIRKNINKISVWTKADAGD 167
            .:|...:||::|| ||.|:
Zfish   154 NVRTKGDKIAIWT-ADYGN 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 67/133 (50%)
eif4ebNP_001007778.1 IF4E 40..196 CDD:279921 67/133 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.