DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and MGC89871

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001005099.1 Gene:MGC89871 / 448677 XenbaseID:XB-GENE-973579 Length:234 Species:Xenopus tropicalis


Alignment Length:177 Identity:59/177 - (33%)
Similarity:90/177 - (50%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QTKESSEFKMGTSLDNNKLASLGATNK---------HRLQNTWTLWGVKYDP-----EISWEDML 56
            |.:|:...|......|.|..:.|::.|         |.||..:|.|..:..|     ..|:|..:
 Frog    18 QNEENGTQKDSEKEKNEKEKNQGSSRKKSVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNI 82

  Fly    57 KEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAEL 121
            |:|.:|.:||.||..|..:..|..|....|:.|||:||:|||||..||.||:|..::.|...:  
 Frog    83 KQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLAS-- 145

  Fly   122 DKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGDE 168
             :.|.:::|.|:||.....::||||.|.:|...:.||:|.|. |.|:
 Frog   146 -RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKT-ASDQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 48/135 (36%)
MGC89871NP_001005099.1 IF4E 55..214 CDD:366742 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.