DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eif4e3

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001004589.1 Gene:eif4e3 / 447850 ZFINID:ZDB-GENE-040912-156 Length:224 Species:Danio rerio


Alignment Length:178 Identity:57/178 - (32%)
Similarity:81/178 - (45%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENLRQTKESSEFKMGTSLDNNKLASLGATNKHRLQNTWTLWGVKYDP---EISWEDMLKEIDSF 62
            :||:....|.     ||||.              |.:.||.|..:..|   ....|..||:|.:.
Zfish    34 LENITNHVED-----GTSLP--------------LHSPWTFWLDRSLPGTTAAECESNLKKIYTV 79

  Fly    63 NTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLD 127
            :||:.||::|..|...|.|...|.|.|.:...||:||:..|..||.|..||.|.||..:   |.:
Zfish    80 HTVQSFWSVYNNIPPVSCLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKESTLAV---WKE 141

  Fly   128 VLLCMIGEA-CDHC---DQICGAFVRIRKNINKISVWT-KADAGDECN 170
            :||..|||. .|:|   |::.|..|.:|:..:.:.||. .|...:|.|
Zfish   142 LLLATIGEQFTDYCASEDEVVGVSVSVREREDVVQVWNGNASFANEAN 189

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 47/138 (34%)
eif4e3NP_001004589.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
IF4E 51..198 CDD:279921 49/142 (35%)