DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eif4e2rs1

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_957053.1 Gene:eif4e2rs1 / 393732 ZFINID:ZDB-GENE-040426-1728 Length:228 Species:Danio rerio


Alignment Length:178 Identity:56/178 - (31%)
Similarity:91/178 - (51%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ENLRQTKESSEFKMGTSLDNN------KLASLGATNKHRLQNTWTLWGVKYDPE-----ISWEDM 55
            |.::...||..    .|::||      |:.: .|..:|.||..:|.|..:..|.     .|:|..
Zfish    16 EEMKDNNESDR----ASINNNNNNIRRKMVT-PAAGEHPLQYNYTFWYSRRTPSRPANTQSYEQN 75

  Fly    56 LKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAE 120
            ::::.:..:||.||..|..:..|..|....|:.|||:||:|||||..||.||:|..::.|...: 
Zfish    76 IRQMGTVASVEQFWKFYSHLVRPGDLTGHSDFHLFKEGIKPMWEDEANKNGGKWIIRLRKGLAS- 139

  Fly   121 LDKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGDE 168
              :.|.:::|.|:||.....::|||..|.||...:.:|:|.|. |.|:
Zfish   140 --RFWENIILAMLGEQFMVGEEICGVVVSIRFQEDILSIWNKT-ANDQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 44/135 (33%)
eif4e2rs1NP_957053.1 IF4E 52..208 CDD:279921 45/137 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.