DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eIF4E3

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster


Alignment Length:131 Identity:69/131 - (52%)
Similarity:90/131 - (68%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KHRLQNTWTLWGVKYDPEISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRP 96
            ||.|::|||||.::.|....|.:||.::.||||||||:::|:.:..||.|....|||:|||.|||
  Fly    66 KHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRP 130

  Fly    97 MWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWT 161
            ||||..||.||||...:||.|...:||.|.|:|||||||...|.|:|||..:.:|...||:|:||
  Fly   131 MWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGECFQHSDEICGVVINVRNKANKLSLWT 195

  Fly   162 K 162
            |
  Fly   196 K 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 66/126 (52%)
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 66/126 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470288
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
109.900

Return to query results.
Submit another query.