DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eIF4EHP

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:147 Identity:44/147 - (29%)
Similarity:80/147 - (54%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESSEFKMGTSLDNNKLASLG-ATNKHRLQNTWTLWGVKYDPEISWEDMLKEIDSFN---TVEDFW 69
            :|.:..:...:|.:.|..|. ...::|||:|:.||..:.:.:.:..|..|.:....   :|:.:|
  Fly    21 DSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWW 85

  Fly    70 NLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIG 134
            :||..:..|:.|....:.:|||:||.||||||.|..||:|..::.|.   ::|:.|.:|.:.|:|
  Fly    86 SLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKN---KVDRAWENVCMAMLG 147

  Fly   135 EACDHCDQICGAFVRIR 151
            |.....|:|||..::.:
  Fly   148 EQFLVGDEICGVVLQTK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 37/118 (31%)
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438283
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.