DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and Eif4e3

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001100082.1 Gene:Eif4e3 / 297481 RGDID:1586185 Length:207 Species:Rattus norvegicus


Alignment Length:133 Identity:45/133 - (33%)
Similarity:66/133 - (49%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LQNTWTLWGVKYDPEISWEDM---LKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRP 96
            |.:.||.|..:..|..:..:.   ||:|.:..||:.||::|..|...:.|...|.|.|.:...||
  Rat    32 LHSPWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRP 96

  Fly    97 MWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEACDHC----DQICGAFVRIRKNINKI 157
            :||:..|..||.|..||.|.||:.:   |.::||..|||....|    |:|.|..|.:|...:.:
  Rat    97 LWEEESNAKGGVWKMKVPKDSTSTV---WKELLLATIGEQFTDCAAADDEIIGVSVSVRDREDVV 158

  Fly   158 SVW 160
            .||
  Rat   159 QVW 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 44/131 (34%)
Eif4e3NP_001100082.1 IF4E 34..181 CDD:279921 44/131 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.