DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and Eif4e2

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_036021474.1 Gene:Eif4e2 / 26987 MGIID:1914440 Length:265 Species:Mus musculus


Alignment Length:177 Identity:61/177 - (34%)
Similarity:91/177 - (51%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QTKESSEFKMG--TSLDNNKLASLGATN-------KHRLQNTWTLWGVKYDP-----EISWEDML 56
            |.:|:|..|.|  ...|.:|..|.|...       :|.||..:|.|..:..|     ..|:|..:
Mouse    18 QNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNI 82

  Fly    57 KEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAEL 121
            |:|.:|.:||.||..|..:..|..|....|:.|||:||:|||||..||.||:|..::.|...:  
Mouse    83 KQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLAS-- 145

  Fly   122 DKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGDE 168
             :.|.:::|.|:||.....::||||.|.:|...:.||:|.|. |.|:
Mouse   146 -RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKT-ASDQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 48/135 (36%)
Eif4e2XP_036021474.1 IF4E 55..214 CDD:396291 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830815
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.