DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and tif452

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_595451.1 Gene:tif452 / 2539870 PomBaseID:SPBC1709.18 Length:243 Species:Schizosaccharomyces pombe


Alignment Length:158 Identity:64/158 - (40%)
Similarity:86/158 - (54%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LASLGATN-------KHRLQNTWTLWGVKYDPE-ISWEDMLKEIDSFNTVEDFWNLYFRIDTPSK 80
            |..|.|.|       .|.||:.||||.:|...: :.|.|:||||.||.|||:||.::..|...|.
pombe    48 LEGLSAVNAETAFVKTHPLQHEWTLWFLKPPTQGLEWSDLLKEIISFKTVEEFWGIFKTISKASM 112

  Fly    81 LNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEACDHC-DQIC 144
            |....||..|.|||||.||||.|..||:|.|: .|...:.||:.||.::|..|||..|.. .::.
pombe   113 LPAKSDYSYFLKGIRPEWEDPQNMNGGKWAYQ-SKHKGSNLDELWLYMVLAAIGETLDPTGKEVT 176

  Fly   145 GAFVRIRKNINKISVWTKADAGDECNEQ 172
            |....:||...:|:|||:     .||::
pombe   177 GVVCNMRKGFYRIAVWTR-----NCNDK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 55/132 (42%)
tif452NP_595451.1 CDC33 16..243 CDD:227386 64/158 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 134 1.000 Domainoid score I1275
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
OMA 1 1.010 - - QHG54586
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9263
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.