DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and EIF4E1B

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001092878.1 Gene:EIF4E1B / 253314 HGNCID:33179 Length:242 Species:Homo sapiens


Alignment Length:132 Identity:68/132 - (51%)
Similarity:86/132 - (65%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HRLQNTWTLWGVKYDPEISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPM 97
            |.|||.|.||..|.|...:|:|.|..:...:||||||.||..|...|||:.||||.|||.||:||
Human    62 HPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPM 126

  Fly    98 WEDPPNKGGGRWTYKVDKRST-AELDKTWLDVLLCMIGEAC-DHCDQICGAFVRIRKNINKISVW 160
            |||..||.||||...:.|:.. .|||:.||:.|||:|||:. :|..::|||.|.||...:||:||
Human   127 WEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVW 191

  Fly   161 TK 162
            |:
Human   192 TR 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 65/128 (51%)
EIF4E1BNP_001092878.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
EIF4EBP1/2/3 binding. /evidence=ECO:0000250 62..65 1/2 (50%)
IF4E 63..222 CDD:366742 67/131 (51%)