DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001273108.1 Gene:Eif4e1b / 218268 MGIID:2685119 Length:250 Species:Mus musculus


Alignment Length:139 Identity:68/139 - (48%)
Similarity:91/139 - (65%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HRLQNTWTLWGVKYDPEISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPM 97
            |.||..|.||..|.|...:|:|.|:.:..||||||||.:|..|...|||:.||||.|||:||.||
Mouse    71 HPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPM 135

  Fly    98 WEDPPNKGGGRWTYKVDKR-STAELDKTWLDVLLCMIGEAC--DHCDQICGAFVRIRKNINKISV 159
            |||..||.||||...:||: ...|||:.||:.|||::|. |  ::..::|||.|.||...:||::
Mouse   136 WEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGN-CFEEYSREVCGAVVNIRTKRDKIAL 199

  Fly   160 WTKADAGDE 168
            || ::|.|:
Mouse   200 WT-SEAEDK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 64/133 (48%)
Eif4e1bNP_001273108.1 IF4E 75..231 CDD:279921 65/135 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830794
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.