DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and EIF4E

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001124151.1 Gene:EIF4E / 1977 HGNCID:3287 Length:248 Species:Homo sapiens


Alignment Length:185 Identity:71/185 - (38%)
Similarity:94/185 - (50%) Gaps:38/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NNKLASLGATNKHRLQNTWTLWGVKYDPEISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGC 85
            |.::|:.....||.|||.|.||..|.|...:|:..|:.|..|:||||||.||..|...|.|..||
Human    25 NQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGC 89

  Fly    86 DYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRS-TAELDKTWLDV--------------------- 128
            ||.|||.||.|||||..||.||||...::|:. .::||:.||:.                     
Human    90 DYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETRWDLAMLPRLVSNFWPQVILP 154

  Fly   129 ----------LLCMIGEAC-DHCDQICGAFVRIRKNINKISVWTKADAGDECNEQ 172
                      |||:|||:. |:.|.:|||.|.:|...:||::||     .||..:
Human   155 LQPPKVLELQLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWT-----TECENR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 63/163 (39%)
EIF4ENP_001124151.1 IF4E 38..228 CDD:366742 67/172 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.