DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and ife-1

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001255196.1 Gene:ife-1 / 176755 WormBaseID:WBGene00002059 Length:231 Species:Caenorhabditis elegans


Alignment Length:138 Identity:62/138 - (44%)
Similarity:82/138 - (59%) Gaps:2/138 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LQNTWTLWGVKYDPEISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWE 99
            |:..||.|.:..:...||||.||::.:||||.:||.||..|..||.||..|||.:|:..|:||||
 Worm    33 LKRNWTWWYLNDERNKSWEDRLKKVYTFNTVSEFWALYDAIRPPSGLNALCDYNVFRDDIQPMWE 97

  Fly   100 DPPNKGGGRWTYKVDKRSTAEL-DKTWLDVLLCMIGEAC-DHCDQICGAFVRIRKNINKISVWTK 162
            .|.|..||||...:||..|.|: |..||::|:.::||.. ...:.|||....:|...:|||||||
 Worm    98 VPENSNGGRWLIVIDKGKTPEMVDAIWLEILMALVGEQFGKDMESICGLVCNVRGKGSKISVWTK 162

  Fly   163 ADAGDECN 170
            ....||.|
 Worm   163 DCNDDETN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 58/132 (44%)
ife-1NP_001255196.1 IF4E 37..181 CDD:279921 61/134 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.