DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E6 and eif4e1b

DIOPT Version :9

Sequence 1:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_002936991.4 Gene:eif4e1b / 100127761 XenbaseID:XB-GENE-6258261 Length:217 Species:Xenopus tropicalis


Alignment Length:155 Identity:73/155 - (47%)
Similarity:95/155 - (61%) Gaps:14/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LDNNKLAS------LGATNKHRLQNTWTLW---GVKYDPEISWEDMLKEIDSFNTVEDFWNLYFR 74
            |||.|...      |....||.||:.|.||   .||..|   |:..|:.:.:||||||||:||..
 Frog    17 LDNEKRRKKKESVILEKVIKHSLQSRWALWFFKNVKSQP---WQCNLRLVTTFNTVEDFWSLYTH 78

  Fly    75 IDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRST-AELDKTWLDVLLCMIGEACD 138
            |...|||:.||||.|||.||.|||||..||.||||...:.|:.. ::||..||:.|||:||||.|
 Frog    79 IQLASKLSSGCDYSLFKDGIEPMWEDSRNKRGGRWLITLSKQQRHSDLDALWLETLLCLIGEAFD 143

  Fly   139 -HCDQICGAFVRIRKNINKISVWTK 162
             :.:::|||.:.||...:||::||:
 Frog   144 EYSEEVCGAVINIRAKGDKIAIWTR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 64/131 (49%)
eif4e1bXP_002936991.4 IF4E 39..197 CDD:396291 66/133 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.