DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG14456

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:85 Identity:22/85 - (25%)
Similarity:37/85 - (43%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSRNKVCLNVDANL---------LHPVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRRRNNAL 105
            ||...|..|.|.:|         ||.| |:.|:.|:..:.:.|.....:.:.:.|:.:...|.:.
  Fly    41 VSHKVVYDNSDPHLNFSMEVHQELHDV-DIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSP 104

  Fly   106 I-RIVWELFKEYSTINHTCP 124
            : |.|....:|:..|..|||
  Fly   105 VGRFVHGFIREFGNIVETCP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 10/43 (23%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 10/43 (23%)

Return to query results.
Submit another query.