DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG12849

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:159 Identity:45/159 - (28%)
Similarity:77/159 - (48%) Gaps:21/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWLY 88
            |:..|.||...::.:::|..|.|::|:|....|::...:.. ||.:...:.:|..|.|  :..||
  Fly    21 FEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMREN--RRVLY 83

  Fly    89 SVSF--DGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPTP------- 144
            :..|  |.|:|:|.|.:.:...|::.|..||.:||||||       :..:..:|||..       
  Fly    84 NFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPY-------DHDIVLDKLPVQHLNKLVQ 141

  Fly   145 --IPTGEYLLMIDWVFNKKPQAATNVYFT 171
              ||.|.|::...|:....|:....:|||
  Fly   142 SIIPDGRYMMNSTWMVAGIPRTDVILYFT 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 30/100 (30%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 30/98 (31%)

Return to query results.
Submit another query.