DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14518 and CG13561

DIOPT Version :10

Sequence 1:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:154 Identity:51/154 - (33%)
Similarity:87/154 - (56%) Gaps:4/154 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWL 87
            :.|.||..|.:.::::....||||.||.|:.|.:::.||:|. |...|.::.:|||:|:||||:|
  Fly    22 VAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGYKPFL 86

  Fly    88 YSV-SFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLP-TPIPTGEY 150
            |:: ..|.|:::.:||:..|.|:...|...:.:| .||......:::|....:.|. .|:|.|:|
  Fly    87 YNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPVKVLDMMPLPFGDY 150

  Fly   151 LLMIDWVFNKKPQAATNVYFTFVE 174
            .|...:.|::...|...||||..|
  Fly   151 GLFTTFTFHRSELAQVKVYFTLTE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14518NP_651653.2 DM8 83..173 CDD:214778 28/91 (31%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 28/91 (31%)

Return to query results.
Submit another query.